- Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1155.2 (MJ1155.2)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1117563
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 7,963 Da
- E Coli or Yeast
- 26665
- MJ1155.2
- Uncharacterized protein MJ1155.2 (MJ1155.2)
Sequence
MILDKTLFSSLTFSLTVLFLLLLIPNLKGFGKLSAIIGGFIALIFQYFGYPSLGILFAGILSPIIILKIKSVK